PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0280400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 258aa    MW: 27996.1 Da    PI: 9.3938
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0280400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.74e-33162218158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep+YVNaKQy++Il+RRq+Rak+e ekk+  ksrkpylheSRh+hA+rR+Rg+gGrF
  ORGLA03G0280400.1 162 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-VKSRKPYLHESRHQHAMRRARGTGGRF 218
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-37160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.398161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.6E-29163218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.5E-25164186IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860166186IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.5E-25195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MESRPGGTNL VETRGQGALP SGIPIQQPWW TTSAGVGAVS PAVVAPGSGA GISLSGRDGG  60
GDDAAEESSD DSRRSGETKD GSTGQEKHHA TSQMTALASD YLTPFSQLEL NQPIASAAYQ  120
YPDSYYMGMV GPYGPQAMSA QTHFQLPGLT HSRMPLPLEI SEEPVYVNAK QYHGILRRRQ  180
SRAKAELEKK VVKSRKPYLH ESRHQHAMRR ARGTGGRFLN TKKNEDGAPS EKAEPNKGEQ  240
NSGYRRIPPD LQLLQKET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21162225265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880300.0AB288030.1 Oryza sativa Japonica Group OsHAP2D mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0698540.0AK069854.1 Oryza sativa Japonica Group cDNA clone:J023036P10, full insert sequence.
GenBankEU8470120.0EU847012.1 Oryza sativa Japonica Group clone KCS256D08 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632634.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632635.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632636.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632637.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLI1PEK80.0I1PEK8_ORYGL; Uncharacterized protein
STRINGORGLA03G0280400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-40nuclear factor Y, subunit A9